DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and cela2a

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_017945752.1 Gene:cela2a / 594883 XenbaseID:XB-GENE-970278 Length:269 Species:Xenopus tropicalis


Alignment Length:270 Identity:80/270 - (29%)
Similarity:129/270 - (47%) Gaps:23/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ILQLVLIVQFSLVFGQETGS---LRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNR 63
            :|.|||.:..:...|..|..   .|::||........|:||.|...:.|.  ..:.|||:::|:.
 Frog     4 LLVLVLCLAGAYCCGVPTYQPVVSRVVNGEDVAPHSWPWQVSLQYLYYGY--WYHTCGGSLISSN 66

  Fly    64 WIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTN--DIALIKLPK 126
            |::|||||:.  ..|.::|.:....::..:..:.::|.|..|.|.::|..::.|  ||:||||.:
 Frog    67 WVLTAAHCIS--SYNTYRVQLGKHNLRYIEPGQKIINVSKLINHPRWDPNSLGNGFDISLIKLEE 129

  Fly   127 KLTFNKYIQPAKLPSAKKTYTGR-KAIISGWG-LTTKQLPSQVLQYIRAPIISNKECERQWNKQL 189
            .:.|:..:|||.||.|......: ...::||| :.|......:||.....::....|. ||:...
 Frog   130 SVDFSDTVQPACLPPAGYILPHQYGCYVTGWGNIRTGGPEPDILQQGLLLVVDYATCS-QWDWWG 193

  Fly   190 GGKSKKVVHNGFICIDSKKGL--PCRGDSGGPMVLDDGSRT--LVGIVSHGFDGECKL-KLPDVS 249
            .|     |....||... .|:  .|.||||||:...:.:.|  :.|:||.|....|.. |.|.|.
 Frog   194 DG-----VRTNMICAGG-DGITSSCNGDSGGPLNCRNANGTWEVHGVVSFGSAAGCNYPKKPSVF 252

  Fly   250 TRVSSYLKWI 259
            :|||.:..||
 Frog   253 SRVSEFNSWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 72/244 (30%)
Tryp_SPc 24..260 CDD:238113 73/245 (30%)
cela2aXP_017945752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.