DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG34409

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:119/272 - (43%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87
            |::.|..|.|.|.|:...:......|......|.|:::|:..|:|||||:.:..|:|....:.:|
  Fly   249 RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLG 313

  Fly    88 KVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKL--------PKKLTFNKYIQPAKLPSAKK 144
            .    .|..........|||..:|:....|||||:::        |..|.||..|      :...
  Fly   314 S----QDGATPFAIEQVIVHPNYDQPKYANDIALLRINSTNGTFTPICLPFNGPI------TLGN 368

  Fly   145 TYTGRKAIISGWGLTTKQLPSQV--------LQYIRAPIISNKECERQW-----NKQLGGKSKKV 196
            ...|:..:.:||.:.:.:..|.:        :::||.||::...|...:     |.|    ...|
  Fly   369 RLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQ----QPIV 429

  Fly   197 VHNGFICIDSKKGLP----CRGDSGGPMVLDDGSR---------TLVGIVSHGFDGECKL-KLPD 247
            :....:|   .:|:|    ||||||||. :|||:.         |::|||:.| ...|.: .:|.
  Fly   430 ITPNHLC---AQGMPMNDVCRGDSGGPF-MDDGTSGVFGTSGRYTIIGIVAFG-PTLCGVTTIPG 489

  Fly   248 VSTRVSSYLKWI 259
            |.|.|||:..||
  Fly   490 VYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 72/270 (27%)
Tryp_SPc 24..260 CDD:238113 73/271 (27%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 72/270 (27%)
Tryp_SPc 252..501 CDD:238113 71/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.