DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG34171

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:277 Identity:71/277 - (25%)
Similarity:121/277 - (43%) Gaps:35/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILQLVLIVQFSLVFGQETGSLRIMNGTAAKAKQL-PYQVGLLC--YFEGSKDEPNMCGGTILSN 62
            |:|...|:::.:||..:...:::|.:........| .|.|.|..  |.....|. :.|.|.||:|
  Fly     1 MLLAYFLLLKIALVLPKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDN-HFCTGVILTN 64

  Fly    63 RWIITAAHCLQD-------PKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIA 120
            |.::|:|||:.|       ||..:  |.:.....|:.:.:|.||:....|:|..:.|.. .||||
  Fly    65 RHVLTSAHCITDKNGVMMSPKRIV--VALCASLFKTPESEEFVVDIHNMIIHPYYHRNQ-HNDIA 126

  Fly   121 LIKLPKKLTFN-KYIQPAKLPSAKKTYTGRKAIISG-WGLTTKQLPSQVLQYIRAPIISNKECER 183
            :|||.:.:..: .::.|..|.::..........|.| :|:..::..|     ..:.::.|.|. |
  Fly   127 IIKLKRYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGS-----FHSMLLVNVEL-R 185

  Fly   184 QWNKQLGGKSKKVV------HNGFICIDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECK 242
            .:::.|  |.||.:      :...||:.|.:...|..|.|||:..|.   .|.||.....:  |.
  Fly   186 PFDECL--KVKKSLMAARPENEDLICVKSTEKQMCTTDFGGPLFCDG---QLYGIALGSIN--CS 243

  Fly   243 LKLPDVSTRVSSYLKWI 259
            ...|...:.||.|..|:
  Fly   244 SPDPVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 65/253 (26%)
Tryp_SPc 24..260 CDD:238113 66/254 (26%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 64/247 (26%)
Tryp_SPc 38..263 CDD:304450 64/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.