DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Prss21

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:267 Identity:78/267 - (29%)
Similarity:127/267 - (47%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQ---DP-- 75
            |..|...||:.|..|:..:.|:|..|..:  |:    ::||.|:|:.||::|||||.|   ||  
Mouse    47 GHRTIPSRIVGGDDAELGRWPWQGSLRVW--GN----HLCGATLLNRRWVLTAAHCFQKDNDPFD 105

  Fly    76 ----------KSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTF 130
                      :.:||.:..:..:   :..::|.::..|:        :...|||||:||...:|:
Mouse   106 WTVQFGELTSRPSLWNLQAYSNR---YQIEDIFLSPKYS--------EQYPNDIALLKLSSPVTY 159

  Fly   131 NKYIQPAKLPSAKKTYTGR-KAIISGWGL--TTKQLPS-QVLQYIRAPIISNKECERQWNKQLGG 191
            |.:|||..|.::...:..| ...::|||.  ..:.||| ..||.::..||:|..|...:.|.   
Mouse   160 NNFIQPICLLNSTYKFENRTDCWVTGWGAIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKP--- 221

  Fly   192 KSKKVVHNGFICIDSKKG--LPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKLPDVSTRVS 253
            ..:..:....:|..:.:|  ..|.||||||:..| |.....||:||.|. |..:...|.|.|.:|
Mouse   222 DFRTNIWGDMVCAGTPEGGKDACFGDSGGPLACDQDTVWYQVGVVSWGI-GCGRPNRPGVYTNIS 285

  Fly   254 SYLKWIK 260
            .:..||:
Mouse   286 HHYNWIQ 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 74/257 (29%)
Tryp_SPc 24..260 CDD:238113 74/257 (29%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 74/257 (29%)
Tryp_SPc 55..294 CDD:238113 75/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.