DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:291 Identity:86/291 - (29%)
Similarity:137/291 - (47%) Gaps:47/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQLVLIVQFSL----VFGQETGSL--RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILS 61
            |.|::.|:.||    |.|:...:|  ||:.|..|.....|:.|.|    :|...  :.|||::::
Zfish     9 LLLLMYVRDSLSNLQVCGRPNPTLNPRIVGGVNATHGAWPWMVSL----QGRYG--HFCGGSLIN 67

  Fly    62 NRWIITAAHCL--QDPKSNLWKVLIHVGKVKSF--DDKEIVVNRSYTIVHKKFDRKTVTNDIALI 122
            |:|::|||||:  |.|.|    :::::||.:|:  |...|.....:.|.|..:...|..|||||:
Zfish    68 NQWVLTAAHCIVDQTPSS----IIVYLGKWRSYVADVNSISRTIRHIIPHPSYSNITKDNDIALL 128

  Fly   123 KLPKKLTFNKYIQPAKLPSAKKTY-TGRKAIISGW------------GLTTKQLP---SQVLQYI 171
            :|...:.:..||:|..|......: .|..:.::||            |.||..:|   ..:||..
Zfish   129 QLTSTVQYTDYIKPICLADENSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEA 193

  Fly   172 RAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKG--LPCRGDSGGPMVLDDGSRTLVGIVS 234
            ...:.||.:|    |....|:    :....||..::.|  ....||||||::.........|::|
Zfish   194 ELKVYSNADC----NNICHGR----ITPNMICAGTRPGGKATFSGDSGGPLMTKCSVWVQAGVLS 250

  Fly   235 HGFDGECKLKLPDVSTRVSSYLKWIKYYSGG 265
            ||: |..:..||:|..|||.|.:||....||
Zfish   251 HGY-GCAQPNLPEVFIRVSEYKQWITGNVGG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 74/257 (29%)
Tryp_SPc 24..260 CDD:238113 74/257 (29%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.