DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and tmprss9

DIOPT Version :10

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_021325244.1 Gene:tmprss9 / 562051 ZFINID:ZDB-GENE-050208-573 Length:788 Species:Danio rerio


Alignment Length:254 Identity:80/254 - (31%)
Similarity:133/254 - (52%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQ---DPKSNLWKV 82
            |.||:.|...:..:.|:||.|  ...|.    :.||.:|:::||:::||||.:   :||.  |..
Zfish   229 SNRIVGGENTRHGEFPWQVSL--RLRGR----HTCGASIVNSRWLVSAAHCFEVENNPKD--WTA 285

  Fly    83 LIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYT 147
            |:...:|...:.:..:||....::..|:|..|..:|:.:::|...|.|:.|:||..:||:...:|
Zfish   286 LVGANQVSGAEAEAFIVNIKSLVMSPKYDPMTTDSDVTVLELETPLKFSHYVQPVCIPSSSHVFT 350

  Fly   148 -GRKAIISGWGLT---TKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFI--CIDS 206
             |:..|:||||..   |.::|| .||.....||.:|.|.:. :...|..::.::..||:  .:||
Zfish   351 PGQNCIVSGWGALNQYTTEVPS-TLQKAIVKIIDSKVCNKS-SVYRGALTQNMMCAGFLQGKVDS 413

  Fly   207 KKGLPCRGDSGGPMVLD--DGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYS 263
                 |:||||||:..:  .|...|.||||.|. |..::..|.|.:||:....||..|:
Zfish   414 -----CQGDSGGPLACEVAAGRYFLAGIVSWGV-GCAQINKPGVYSRVTKLRNWIVSYT 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 76/246 (31%)
tmprss9XP_021325244.1 SEA 52..>127 CDD:460188
LDLa 185..220 CDD:238060
Tryp_SPc 232..462 CDD:238113 75/245 (31%)
LDLa 510..544 CDD:238060
Tryp_SPc 557..783 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.