DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and zgc:112285

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:257 Identity:82/257 - (31%)
Similarity:127/257 - (49%) Gaps:27/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPK---SNLWKVLI 84
            ||::|..|:....|:||.|.....|||...::||||::...|::|||||.|..|   ::.|::::
Zfish    58 RIVSGNEARPHSWPWQVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKGKAEDASSWRIVL 122

  Fly    85 HVGKVKSFDDKE--IVVNRSYTIVHKKFD-RKTVTNDIALIKLPKKLTFNKYIQPAKLPSAK-KT 145
            ...::|..:..|  ..|.|.|...|.::. ...:..||||:|....:..:.:|:.|.||..: ..
Zfish   123 GKHQLKRSETAERFFPVKRIYRHEHFRYPAHSELDYDIALVKAATDIQPSNFIRYACLPRKQINL 187

  Fly   146 YTGRKAIISGWGLTT--KQLPS--QVLQYIRAPIISNKECERQ--WNKQLGGKSKKVVHNGFICI 204
            ..|....::|||.|.  |:..|  :.|...|.|||..|.|.::  |..:        |.:..||.
Zfish   188 NPGHYCWVTGWGDTRGGKENVSLAEALNQARLPIIDYKTCRQKKFWGDR--------VRDSMICA 244

  Fly   205 DSK--KGLP--CRGDSGGPMVLDDG-SRTLV-GIVSHGFDGECKLKLPDVSTRVSSYLKWIK 260
            ..:  :|.|  |:||||||::...| .|..| ||||.|..|......|.|.||.::|:.||:
Zfish   245 GFRDTEGTPAACQGDSGGPLLCQVGRDRWEVHGIVSFGPIGCTVENKPSVFTRTAAYIPWIE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 80/254 (31%)
Tryp_SPc 24..260 CDD:238113 80/254 (31%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 80/254 (31%)
Tryp_SPc 59..308 CDD:238113 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.