DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and cela1.1

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:256 Identity:74/256 - (28%)
Similarity:118/256 - (46%) Gaps:27/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87
            |::.|..||....|:|:.|. |..|.:.. :.||||::...|::.||||:.  .|.:|.|.:...
Zfish    29 RVIGGEIAKPHSWPWQISLQ-YQSGGRYH-HYCGGTLIRPGWVMVAAHCVD--TSRIWSVALGDH 89

  Fly    88 KVKSFDDKEIVVNRSYTIVHKKFDRKTVT--NDIALIKLPKKLTFNKYIQPAKLPSAKKTYT-GR 149
            ...:.:..|..::.....:|..::...|.  |||||::|....|.:.|:|.|.|||..:... |.
Zfish    90 DTTTHEGPEQYISVKGVFIHPNWNPNIVANGNDIALLQLSINATLSSYVQVATLPSYGEILPYGH 154

  Fly   150 KAIISGWGLTTK--QLPSQVLQ-YIRAPIISNKECERQ--WNKQLGGKSKKVVHNGFICIDSKKG 209
            ...|:|||.|..  .|.:|:.| |:  |::.::.|.:.  |.        ..|.:..||......
Zfish   155 TCYITGWGRTQTGGSLSAQLKQAYM--PVVDHETCSQSDWWG--------STVKDRMICAGGTTS 209

  Fly   210 L-PCRGDSGGPM-VLDDGSRTLVGIVSHGFDGECK-LKLPDVSTRVSSYLKWIKY--YSGG 265
            : .|.||||.|: .|.:|...:.|:.|......|. .|.|.|.||||.::.|:.:  |..|
Zfish   210 MSACHGDSGSPLNCLFNGEYVVHGVTSFVASSGCNTYKKPTVFTRVSYHVSWLNHIMYENG 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/246 (29%)
Tryp_SPc 24..260 CDD:238113 71/246 (29%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 71/245 (29%)
Tryp_SPc 30..265 CDD:238113 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.