DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and ctrb.3

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:269 Identity:83/269 - (30%)
Similarity:128/269 - (47%) Gaps:31/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLIVQFSLVFG--------QETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILS 61
            |..:..||..:|        ..:|..||:||..|.....|:||.|. .|.|.    :.|||::::
Zfish     7 LSCVAFFSAAYGCGVPAIPPVVSGYARIVNGEEAVPHSWPWQVSLQ-DFTGF----HFCGGSLIN 66

  Fly    62 NRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEI-VVNRSYTIVHKKFDRKTVTNDIALIKLP 125
            ..|::|||||  ..:::...:|....|.||...::| .:..|....|.:::..|:.|||||:||.
Zfish    67 EFWVVTAAHC--SVRTSHRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIENDIALVKLT 129

  Fly   126 KKLTFNKYIQPAKLPSAKKTY-TGRKAIISGWGLTTKQ---LPSQVLQYIRAPIISNKECERQWN 186
            ...:.|.::.|..|..|...: :|...:.||||:|...   .|.: ||.:..|::||::|:..|.
Zfish   130 APASLNAHVSPVCLAEASDNFASGMTCVTSGWGVTRYNALFTPDE-LQQVALPLLSNEDCKNHWG 193

  Fly   187 KQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKLPDVST 250
            ..        :.:..||..:.....|.||||||:|.. |...|||||||.| ...|...:|.|..
Zfish   194 SN--------IRDTMICAGAAGASSCMGDSGGPLVCQKDNIWTLVGIVSWG-SSRCDPTMPGVYG 249

  Fly   251 RVSSYLKWI 259
            ||:....|:
Zfish   250 RVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 77/241 (32%)
Tryp_SPc 24..260 CDD:238113 77/242 (32%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 77/241 (32%)
Tryp_SPc 34..261 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.