DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Tpsab1

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:274 Identity:79/274 - (28%)
Similarity:136/274 - (49%) Gaps:22/274 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ILQLVLIVQFSLVFGQETGSL---RIMNGTAAKAKQLPYQVGLL---CYFEGSKDEPNMCGGTIL 60
            :|.|.|.:..|||....:.::   .|:.|..|...:.|:||.|.   .|:      .:.|||:::
  Rat    41 LLLLTLPLLSSLVHAAPSLAMPREGIVGGQEASGNKWPWQVSLRVNDTYW------MHFCGGSLI 99

  Fly    61 SNRWIITAAHCLQDPKSNLWKVLIHVGK-VKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKL 124
            ..:|::|||||:...|::..|:.:.:.| ...:.|..:.|  |..|.|..|.......||||:||
  Rat   100 HPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTV--SQIISHPDFYIAQDGADIALLKL 162

  Fly   125 PKKLTFNKYIQPAKLPSAKKTY-TGRKAIISGWGLTTKQL---PSQVLQYIRAPIISNKECERQW 185
            ...:.....:....||.|.:|: :|....::|||.....:   |...|:.::.||:.|:.|:.::
  Rat   163 TNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKY 227

  Fly   186 NKQLG-GKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKLPDV 248
            :|.|. |.:..:|.:..:|..::....|:||||||:|.. :.:....|:||.| :|..:...|.:
  Rat   228 HKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWG-EGCAQPNRPGI 291

  Fly   249 STRVSSYLKWIKYY 262
            .|||:.||.||..|
  Rat   292 YTRVTYYLDWIYRY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/245 (29%)
Tryp_SPc 24..260 CDD:238113 71/245 (29%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 70/244 (29%)
Tryp_SPc 66..302 CDD:238113 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.