DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and ctrl

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:258 Identity:74/258 - (28%)
Similarity:120/258 - (46%) Gaps:47/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPN---MCGGTILSNRWIITAAHCL-------- 72
            :|..||:||..|.:...|:||.|        .:.|   .|||::::..|::|||||.        
Zfish    27 SGYNRIVNGENAVSGSWPWQVSL--------QQSNGFHFCGGSLINQYWVVTAAHCRVQAGYHYV 83

  Fly    73 ----QDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKY 133
                .|..|:...|     :|||.         :..|.|..::.:...|||.|:||.........
Zfish    84 ILGEHDRGSSAESV-----QVKSI---------AKAITHPYYNSQNFNNDITLLKLSSPAQLTSR 134

  Fly   134 IQPAKLPSAKKTY-TGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVV 197
            |.|..|.::..:. :|.:.:.:|||.|......::||....|::|..:|::.|     |:::  :
Zfish   135 ISPVCLAASSTSIPSGTRCVTTGWGKTGSTSSPRILQQTALPLLSPAQCKQYW-----GQNR--I 192

  Fly   198 HNGFICIDSKKGLPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259
            .:..||..:.....|:||||||:|.: .|:...|||||.| ..:|.::.|.|..|||...:||
Zfish   193 TDAMICAGASGVSSCQGDSGGPLVCESSGAWYQVGIVSWG-TSDCNVRTPAVYARVSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/252 (28%)
Tryp_SPc 24..260 CDD:238113 72/253 (28%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 71/252 (28%)
Tryp_SPc 32..257 CDD:238113 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.