DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CTRB2

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:252 Identity:82/252 - (32%)
Similarity:119/252 - (47%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHC---LQDPKSNLW 80
            :|..||:||..|.....|:||.|     ..|...:.|||:::|..|::|||||   ..|      
Human    29 SGLSRIVNGEDAVPGSWPWQVSL-----QDKTGFHFCGGSLISEDWVVTAAHCGVRTSD------ 82

  Fly    81 KVLIHVGKVKSFDDKEIVVNRSYTIVHK--KFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAK 143
              ::..|:.....|:|.:.......|.|  ||...||.|||.|:||.....|::.:....||||.
Human    83 --VVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSAD 145

  Fly   144 KTY-TGRKAIISGWGLT---TKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICI 204
            ..: .|.....:|||.|   ..:.|.: ||....|::||.||::.|.::        :.:..||.
Human   146 DDFPAGTLCATTGWGKTKYNANKTPDK-LQQAALPLLSNAECKKSWGRR--------ITDVMICA 201

  Fly   205 DSKKGLPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIK 260
            .:.....|.||||||:|.. ||:.|||||||.| ...|....|.|..||:..:.|::
Human   202 GASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWG-SRTCSTTTPAVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 80/245 (33%)
Tryp_SPc 24..260 CDD:238113 80/245 (33%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 80/245 (33%)
Tryp_SPc 34..259 CDD:238113 80/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.