DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:248 Identity:84/248 - (33%)
Similarity:124/248 - (50%) Gaps:26/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87
            ||.||..|...::||.||||  |.|:.:.  .|||:|:.|.|::|||||......    |.|:.|
  Fly    37 RITNGYPAYEGKVPYIVGLL--FSGNGNW--WCGGSIIGNTWVLTAAHCTNGASG----VTINYG 93

  Fly    88 -KVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAK---KTYTG 148
             .:::.......|.....:.|..::...:.|||:||:.| .:.|...:...:|||..   :.|.|
  Fly    94 ASLRNQPQYTHWVGSGNFVQHHHYNSGNLHNDISLIRTP-HVDFWHLVNKVELPSYNDRYQDYAG 157

  Fly   149 RKAIISGWGLTTKQLP-SQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKG-LP 211
            ..|:.||||.|....| ...||.:...|:|..:|.|.|:          :|:..|||::..| ..
  Fly   158 WWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWS----------LHDNMICINTNGGKST 212

  Fly   212 CRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264
            |.||||||:|..:|:| |||:.|......|:...|.|.:||:.||.||:..:|
  Fly   213 CGGDSGGPLVTHEGNR-LVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIRDNTG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 81/241 (34%)
Tryp_SPc 24..260 CDD:238113 81/241 (34%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 81/241 (34%)
Tryp_SPc 38..262 CDD:238113 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470999
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.