DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:279 Identity:83/279 - (29%)
Similarity:131/279 - (46%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVQFSLVFGQET----GSL--RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPN--MCGGTILSNR 63
            |.|..|||..::.    |.:  ||.||..|...|:||.||:.....|     |  .|||:|:.:.
  Fly    18 LTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNG-----NWWWCGGSIIGHT 77

  Fly    64 WIITAAHCL--QDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKT----VTNDIALI 122
            |::|||||.  .|..|      ::.|.| ::::...    .:|:..:.|.|..    :.:|:|||
  Fly    78 WVLTAAHCTAGADEAS------LYYGAV-NYNEPAF----RHTVSSENFIRYPHYVGLDHDLALI 131

  Fly   123 KLPKKLTFNKYIQPAKLPSAK---KTYTGRKAIISGWGLTTKQLPSQVLQYIRA---PIISNKEC 181
            |.| .:.|...:...:|||..   .:|.......:|||....  .|.|::.:|.   .:||..||
  Fly   132 KTP-HVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYD--GSNVVEDLRVVDLKVISVAEC 193

  Fly   182 ERQWNKQLGGKSKKVVHNGFICIDSKKG-LPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKL 245
            :..:......::.       ||:::..| ..|:||||||:|..:|.: |:||.|......|::..
  Fly   194 QAYYGTDTASENT-------ICVETPDGKATCQGDSGGPLVTKEGDK-LIGITSFVSAYGCQVGG 250

  Fly   246 PDVSTRVSSYLKWIKYYSG 264
            |...|||:.||:|||..:|
  Fly   251 PAGFTRVTKYLEWIKEETG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 73/250 (29%)
Tryp_SPc 24..260 CDD:238113 73/250 (29%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 73/250 (29%)
Tryp_SPc 41..266 CDD:238113 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471003
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.