DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:255 Identity:90/255 - (35%)
Similarity:124/255 - (48%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87
            ||.||..|...::||.||||  |.|:.:.  .|||:|:.|.|::|||||......    |.|:.|
  Fly    35 RITNGYPAYEGKVPYIVGLL--FSGNGNW--WCGGSIIGNTWVLTAAHCTNGASG----VTINYG 91

  Fly    88 KVKSFDDKEIVVNRSYT--------IVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAK- 143
                   ..|.....||        |.|..::...:.|||:||:.| .:.|...:...:|||.. 
  Fly    92 -------ASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTP-HVDFWSLVNKVELPSYND 148

  Fly   144 --KTYTGRKAIISGWGLTTKQLP-SQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICID 205
              :.|.|..|:.||||.|....| ...||.:...|||..:|.|.|:          :|:..|||:
  Fly   149 RYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWS----------LHDNMICIN 203

  Fly   206 SKKG-LPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264
            :..| ..|.||||||:|..||:| |||:.|.|....|:...|.|.:||:.||.||:..:|
  Fly   204 TDGGKSTCGGDSGGPLVTHDGNR-LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDNTG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 87/248 (35%)
Tryp_SPc 24..260 CDD:238113 87/248 (35%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 88/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470995
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.