DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG11843

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:311 Identity:82/311 - (26%)
Similarity:130/311 - (41%) Gaps:69/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVQFSLVFGQE-----TGSLR------------------------------------IMNGTAA 30
            |||..:.||||:     .||..                                    |:.|..|
  Fly    10 LIVSLACVFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPA 74

  Fly    31 KAKQLPYQVGLLCYFEGSKDEPN-----MCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVK 90
            :.::.|:...|     |.:.:|:     .|||.::|.|:::||||||:..:..:  .::.:|:: 
  Fly    75 QPREFPHMARL-----GRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEV--NVVRLGEL- 131

  Fly    91 SFDD-KEIVVNRSYT----IVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRK 150
            .||. .|....|.|.    |.|..::.....:||.|:||.:.:.|:.|..||.||...:. :...
  Fly   132 DFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDER-SSDS 195

  Fly   151 AIISGWGLTTKQL-PSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGL-PCR 213
            .|..|||.|...| ||..|..::.....|..|::...:|:....:....|..:|:.|:... .|.
  Fly   196 FIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCN 260

  Fly   214 GDSGGPMVLDDGS----RTLVGIVSHGFDGEC-KLKLPDVSTRVSSYLKWI 259
            ||||||:::....    ..:|||.|.|.  .| ...:|.:.|||..||.||
  Fly   261 GDSGGPLLMYHREYPCMYVVVGITSAGL--SCGSPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/288 (25%)
Tryp_SPc 24..260 CDD:238113 73/253 (29%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 73/253 (29%)
Tryp_SPc 68..309 CDD:214473 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.