DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG4815

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:254 Identity:73/254 - (28%)
Similarity:114/254 - (44%) Gaps:46/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHV- 86
            ||.||.....:.|. .||:. .|.|.|   .:|..|:|:.|.|:|||||.:    ||.:...|| 
  Fly    34 RIYNGIKTTVESLG-GVGIQ-LFNGRK---LVCSATLLTPRHILTAAHCFE----NLNRSKFHVI 89

  Fly    87 -GKVKSFDDKEIVVNRSYTI---VHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYT 147
             ||...|.......|::..|   :|.|:.:.....|:|:.|....|. :|||..|:| .....:.
  Fly    90 GGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLR-SKYIGYAQL-CRSVLHP 152

  Fly   148 GRKAIISGWGL---TTKQLPSQVLQYIRAPIISNKECERQWNKQL-------GGKSKKVVHNGFI 202
            ..|.|.:|||.   ...:...:..:.::..|:|.::||:|.::::       |..:.|.:     
  Fly   153 RDKLIAAGWGFEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTL----- 212

  Fly   203 CIDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGEC-KLKLPDVSTRVSSYLKWIK 260
                     |.||||||::|   .|.:.||.:..|  :| ..:.|||...|..|.|:||
  Fly   213 ---------CFGDSGGPLLL---GRQVCGINTWTF--KCGNNEKPDVYMGVRYYAKFIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/251 (28%)
Tryp_SPc 24..260 CDD:238113 70/251 (28%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 68/238 (29%)
Trypsin 49..256 CDD:278516 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.