DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG10232

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651175.4 Gene:CG10232 / 42800 FlyBaseID:FBgn0039108 Length:509 Species:Drosophila melanogaster


Alignment Length:266 Identity:73/266 - (27%)
Similarity:120/266 - (45%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHC-LQDPKSNL 79
            ||.....|:..||||:..:.|:...|:..........|.|.|::::.|:::||||| ::|...|.
  Fly   249 GQAPPLYRMAYGTAARPNEYPWMAMLIYENRRLSTMTNNCSGSLINKRYVLTAAHCVVKDKMVNT 313

  Fly    80 WKVL--IHVGK--VKSFDDKE---------IVVNRSYTIVHKK-FDRKTVTNDIALIKLPKKLTF 130
            ..||  :.:|:  :.:..|.:         :.:...|..||:: |:.....:||||::|...:.:
  Fly   314 DLVLRRVRLGEHDITTNPDCDFTGNCAAPFVEIGIEYFNVHEQYFNTSRFESDIALVRLQTPVRY 378

  Fly   131 NKYIQPAKLPSAKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKK 195
            ...|.|..:|............|:|||.|..:..||||       :.|...|.::..|  .|...
  Fly   379 THEILPICVPKDPIPLHNHPLQIAGWGYTKNREYSQVL-------LHNTVYENRYYCQ--DKISF 434

  Fly   196 VVHNGFICIDSKKGL-PCRGDSGGPMVLDDGSR-----TLVGIVSHGFDGECKLKLPDVSTRVSS 254
            ..:...||....:|. .|.||||||::|...:.     .|.||||:|.: .|..:.|.|.|:..:
  Fly   435 FRNESQICASGIRGEDSCEGDSGGPLMLTLNNDYQDIVYLAGIVSYGSE-NCGDRKPGVYTKTGA 498

  Fly   255 YLKWIK 260
            :..|||
  Fly   499 FFSWIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 68/256 (27%)
Tryp_SPc 24..260 CDD:238113 68/256 (27%)
CG10232NP_651175.4 Tryp_SPc 260..506 CDD:238113 70/255 (27%)
Tryp_SPc 260..503 CDD:214473 67/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.