DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG16710

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:128/268 - (47%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPN-----MCGGTILSNRWIITAAHCLQDPKSNLWKV 82
            ||..|...:..:||: :.|:.|...|:...|     .|.|::::||:::||||||:....:|.:|
  Fly   105 RIFGGEETQPNELPW-MALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRV 168

  Fly    83 -------------LIHVGKVKSFDDKEIVVNRSYTIVHKK---FDRKTVTNDIALIKLPKKLTFN 131
                         :.|:...:....:.:.::...:|.|:.   |:.:.. |||||::|...:.:.
  Fly   169 RLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPY-NDIALLRLKFPVRYT 232

  Fly   132 KYIQPAKLP----SAKKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGK 192
            ..|:|..:.    .:..:::..|..|:||||:.||..|.||  ::|.:......|...::...|.
  Fly   233 AQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVL--LQAYVNGRNADECSLSEPSLGL 295

  Fly   193 SKKVVHNGFICIDSKKGL-PCRGDSGGPM--VLDDGSRT---LVGIVSHGFDGECKLKLPDVSTR 251
            .|:.    .||..:..|. .|:||||||:  :::.|...   |.||.|:|: .:|... |...|:
  Fly   296 DKET----HICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGY-SQCGYG-PAAYTK 354

  Fly   252 VSSYLKWI 259
            .|.:::||
  Fly   355 TSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 68/266 (26%)
Tryp_SPc 24..260 CDD:238113 69/267 (26%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 68/266 (26%)
Tryp_SPc 106..362 CDD:238113 67/265 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.