DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG31199

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:192 Identity:42/192 - (21%)
Similarity:73/192 - (38%) Gaps:46/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ILQLVLIVQFSLVFGQETGSLRI---------------MNGTAAKAKQLPYQ---VGLLCY---F 45
            |..|:|:|.   :||.|..|.::               |..|.|    :|.:   |..:.|   |
  Fly     5 IAVLLLLVG---LFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFA----IPTEHQWVARIVYGKGF 62

  Fly    46 EGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG--------KVKSFDDKEIVVNRS 102
            || |...|.|.|.::|.|.::..|||............:|:|        .|:..:.....|..|
  Fly    63 EG-KIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPS 126

  Fly   103 YTI------VHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPS---AKKTYTGRKAIISG 155
            ..|      :|..:|.:|:.|.:|::.|.:.......:.|..:|.   ..:|...:..:::|
  Fly   127 QEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 34/171 (20%)
Tryp_SPc 24..260 CDD:238113 34/170 (20%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.