DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG17477

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:250 Identity:77/250 - (30%)
Similarity:118/250 - (47%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQD-PKSNLWKVLIHVG 87
            |:.|..|.....||||.|.... ||    ::|||.|:|:||||||.||::. |.|.|   .:..|
  Fly    27 IVGGQNAAEGDAPYQVSLQTLL-GS----HLCGGAIISDRWIITAGHCVKGYPTSRL---QVATG 83

  Fly    88 KVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRKAI 152
            .:: :.:...|.......:|..:|.....|||.|:.|.:.:|||...|..:||::.......:.:
  Fly    84 TIR-YAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELV 147

  Fly   153 ISGWGLTTK--QLPSQVLQYIRAPIISNKECERQWNK----QLGGKSKKVVHNGFICIDSKKGL- 210
            .:|||..:.  .|||| ||.::...:::..||...:.    :||     ..|   ||...:..: 
  Fly   148 FTGWGSQSAAGSLPSQ-LQRVQQQHLNSPACESMMSAYEDLELG-----PCH---ICAYRQANIG 203

  Fly   211 PCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSGG 265
            .|.||||||:|   ...|||||::  |...|...:||:...:..|..|::....|
  Fly   204 ACHGDSGGPLV---HQGTLVGILN--FFVPCAQGVPDIFMNIMYYRDWMRQTMSG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 75/242 (31%)
Tryp_SPc 24..260 CDD:238113 76/243 (31%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 76/245 (31%)
Tryp_SPc 27..246 CDD:214473 75/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.