DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG3505

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:263 Identity:74/263 - (28%)
Similarity:135/263 - (51%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCL-QDPKSNLWKVLIHVGK- 88
            |.|..:.::.|: :.|:.|..|::::.:.|||.::|:|:::|||||: |...|||....:.:|: 
  Fly   109 NDTDTRIREFPW-LALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEW 172

  Fly    89 -------VKSFDDKEIV--------VNRSYTIVHKKFDR--KTVTNDIALIKLPKKLTFNKYIQP 136
                   .:..:|.::.        :.....:.|..::|  :|..|||||::|......|.::||
  Fly   173 DTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQP 237

  Fly   137 AKLPSAKKTYTGRKAI---ISGWGLTTKQLPSQVLQYIRAPIISNKECERQW-NKQLGGKSKKVV 197
            ..||:.:......:.:   ::||..::    ||.::.....|.|.:||:|:: ::||..::.|  
  Fly   238 ICLPNKQLRADELEDLVTEVAGWQASS----SQRMRKGYVTISSIEECQRKYASQQLRIQASK-- 296

  Fly   198 HNGFICIDSKKGL----PCRGDSGGPMVL--DDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYL 256
                :|     ||    .|.|::|||::|  :|| ..|.|:||.|.........|||.|||:||:
  Fly   297 ----LC-----GLTNSQECYGNAGGPLMLFKNDG-YLLGGLVSFGPVPCPNPDWPDVYTRVASYI 351

  Fly   257 KWI 259
            .||
  Fly   352 DWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 72/261 (28%)
Tryp_SPc 24..260 CDD:238113 74/263 (28%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 73/261 (28%)
Tryp_SPc 111..354 CDD:214473 71/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.