DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG31326

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:265 Identity:74/265 - (27%)
Similarity:123/265 - (46%) Gaps:33/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQETGSLR--IMNGTAAKAKQLPYQVGLLCYFEGSKDEPN----MCGGTILSNRWIITAAHCLQD 74
            |:|..|..  |..|.:.:..|||:   |:..||  :.|.|    :||||::|...:::||||.:.
  Fly   264 GRERASTTPLIFQGKSLQRGQLPW---LVAIFE--RRESNGPAFICGGTLISTSTVLSAAHCFRA 323

  Fly    75 PKSNL--WKVLIHVGK--VKSFDDKEIVVNRSYTIVHKKFDRKTVTN-DIALIKLPKKLTFNKYI 134
            |..:|  .::.:.:|:  :....|.|. ...|..|:|:.|..|..|. |:||::|.:.:.:..||
  Fly   324 PGRDLPASRLAVSLGRNTLAIHSDGEF-RGVSQLIIHENFQFKQFTEADLALVRLDEPVRYTDYI 387

  Fly   135 QPAKLPSAKKTY---TGRKAIISGWGL-TTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKK 195
            .|..|.|.....   .|.|:.::|||. .|....::|.:.....|:|...|..:....|      
  Fly   388 VPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEANCALELPHVL------ 446

  Fly   196 VVHNGFICIDSKKGLPCRGDSGGPMVL-DDGSRTLVGIVSHGFDGE----CKLKLPDVSTRVSSY 255
             |....:|.......||..|.|||::| :.....|.|::|.|...|    |:|..|.|.|.|:.:
  Fly   447 -VQPSSLCAKKTGAGPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSKPSVFTDVAKH 510

  Fly   256 LKWIK 260
            ::|::
  Fly   511 IEWVR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/255 (27%)
Tryp_SPc 24..260 CDD:238113 71/253 (28%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 70/252 (28%)
Tryp_SPc 277..514 CDD:214473 69/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.