DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG9649

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:283 Identity:76/283 - (26%)
Similarity:132/283 - (46%) Gaps:47/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QFSLVFGQETGSLR-------------IMNGTAAKAKQLPYQVGLLCYFEG-SKDEPNMCGGTIL 60
            |.|..:.|..|.|.             |.||...:..|||:...|   ||. .:|...:||||::
  Fly   230 QASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAAL---FEHVGRDYNFLCGGTLI 291

  Fly    61 SNRWIITAAHCLQDPKSNL--WKVLIHVGKVKSFD--DKEIVVNRSYTIVHKKFDRKTVTN-DIA 120
            |.|.:|:||||.:....||  .:.::.:|: .|.|  .....:..:..::|::::....|: |:|
  Fly   292 SARTVISAAHCFRFGSRNLPGERTIVSLGR-NSLDLFSSGATLGVARLLIHEQYNPNVYTDADLA 355

  Fly   121 LIKLPKKLTFNKYIQP---------AKLPSAKKTYTGRKAIISGWGLTTK-QLPSQVLQYIRAPI 175
            |::|...:....||:|         .:|||..|:|      ::|||...| ...:::.:.....|
  Fly   356 LLQLSNHVDIGDYIKPICLWNENFLLELPSGHKSY------VAGWGEDEKGNRNTRLAKMTDTDI 414

  Fly   176 ISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGL-PCRGDSGGPMVLDDGSRTLV-GIVSHG-- 236
            |:..||    ...|..::.|.:.:..||..:.:.. ||.|||||.::|.:....:: |:||.|  
  Fly   415 ITQWEC----RGNLSEENAKFITSHTICASNAQASGPCSGDSGGGLMLQEQDIWMLRGVVSAGQR 475

  Fly   237 FDGECKLKLPDVSTRVSSYLKWI 259
            ....|.|.||.:.|.|:.:::|:
  Fly   476 MTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/268 (26%)
Tryp_SPc 24..260 CDD:238113 71/256 (28%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 70/254 (28%)
Tryp_SPc 259..497 CDD:214473 69/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.