DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG8870

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:271 Identity:80/271 - (29%)
Similarity:131/271 - (48%) Gaps:56/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GTAAKAKQLPYQVGLLCYFEGSKDEPNM-----CGGTILSNRWIITAAHCLQDPKSNLWKVL--I 84
            |......:.|: :.:|.|  |:|:..:.     |||::::|.:::|||||::.|..:....|  :
  Fly    87 GKIPALNEFPW-MAMLLY--GNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFMDYPYALKTV 148

  Fly    85 HVGKVK-SFDDKEIVVN--RSYT-----------IVHKKFDR-KTVTNDIALIKLPKKLTFNKYI 134
            .:|:.. |.:....:||  |.|.           |.|::|:| :.:.|||||::|...:.:.:.|
  Fly   149 RLGEHNTSTNPDRAIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAI 213

  Fly   135 QPAKLPSAKKTYT-GRKAIISGWGLTTKQLPSQVL--QYI--RAPIISNKECERQWNKQLGGKSK 194
            ||..||.|:|... .||...|||....:.:.|:||  .:|  |.|.:    |:..::..||.:  
  Fly   214 QPICLPRAQKLAAHKRKFQASGWPDMGQGIASEVLLRSFIAERHPDV----CKSNYDFNLGSQ-- 272

  Fly   195 KVVHNGFIC---IDSKKGLPCRGDSGGPMV--LDDGSRTL---VGIVSHGFDGECKLKL--PDVS 249
                   ||   :|.....|  ||||||::  :..|..||   .||:|:| ...|.||.  |...
  Fly   273 -------ICAGGLDGNDTSP--GDSGGPLMETVIRGKVTLTYAAGIISYG-QKPCVLKTCKPAFY 327

  Fly   250 TRVSSYLKWIK 260
            |:.|.:.:|||
  Fly   328 TKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 77/268 (29%)
Tryp_SPc 24..260 CDD:238113 78/269 (29%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 79/265 (30%)
Tryp_SPc 93..337 CDD:214473 76/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.