DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG13318

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:236 Identity:59/236 - (25%)
Similarity:109/236 - (46%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDD----KE 96
            |:|..||     :..:..:.||.:::.:.::||||.:.:.....:||.:......|..:    ::
  Fly   175 PWQAALL-----TTADVYLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQD 234

  Fly    97 IVVNRSYTIVHKKFDRKTVTNDIALIKL--PKKLTFNKYIQPAKLPSAKKTYTGRKAIISGWG-- 157
            :.::..|  |:..|:...:.||:|::||  |..||....:....||:.  ::.|::..::|||  
  Fly   235 VYISNVY--VNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTT--SFVGQRCWVAGWGKN 295

  Fly   158 -LTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGL-PCRGDSGGPM 220
             .........:.:.:..|:|.|..|:........|.|..:....|||...:.|. .|.||.|.|:
  Fly   296 DFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPL 360

  Fly   221 V-LDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIK 260
            | ..:|...:||:|:.|. |..:..:|.|...|.:||.||:
  Fly   361 VCTSNGVWYVVGLVAWGI-GCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 57/233 (24%)
Tryp_SPc 24..260 CDD:238113 58/234 (25%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 59/236 (25%)
Tryp_SPc 169..399 CDD:214473 57/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.