DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and MP1

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:274 Identity:75/274 - (27%)
Similarity:138/274 - (50%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLW 80
            |:..|. |::.|.....::.|: :.|:.|.:....:.:.|||:::::|:::|||||:....|: |
  Fly   131 GENFGD-RVVGGNETTKREFPW-MALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSD-W 192

  Fly    81 KVL-IHVGKVKSFDDKEIVV--------NRSYT-------IVHKKF--DRKTVTNDIALIKLPKK 127
            ::. :.:|:..:..:.:..|        |..|.       |.|.::  :.:...|||||::|..:
  Fly   193 ELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDE 257

  Fly   128 LTFNKYIQPAKLPSA----KKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQ 188
            :.::.:|.|..||:.    ...:.|||.:::|||.|.....|.:........:...||.:::..|
  Fly   258 VQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQ 322

  Fly   189 LGGKSKKVVHNGFICIDSKKGL-PCRGDSGGPMVLDDGSR-----TLVGIVSHGFDGECKLK-LP 246
                 ::.|....:|....:|: .||||||||::|:|.|.     .:.|:||:| ...|.|| .|
  Fly   323 -----RRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYG-PTPCGLKGWP 381

  Fly   247 DVSTRVSSYLKWIK 260
            .|.|||.:||.||:
  Fly   382 GVYTRVEAYLNWIE 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/264 (27%)
Tryp_SPc 24..260 CDD:238113 71/264 (27%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 71/264 (27%)
Tryp_SPc 138..397 CDD:238113 72/266 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.