DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG18223

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:228 Identity:64/228 - (28%)
Similarity:103/228 - (45%) Gaps:45/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NMCGGTILSNRWIITAAHCLQDPKS--NLWKVLIHV----GKVKS-------FDDKEIVVNRSYT 104
            :.|||.|:|..:|:|:|||..|.:.  :..:||:.|    .::||       .:.|:|.|...:|
  Fly    77 HFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFT 141

  Fly   105 IVHKKFDRKTVTNDIALIKLPKKLTF-NKYIQPAKLPSAKKTYTGRKAIISGWGLTTK--QLPSQ 166
            :.:        ||:|||:.|.|||.. |..:....||:|... .|....:.|||...|  .|.|.
  Fly   142 VFN--------TNNIALMMLAKKLPLDNPLVGVINLPTADPE-PGLNYTVLGWGRIFKGGPLASD 197

  Fly   167 VLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGL----PCRGDSGGPMVLDDGSR 227
            :| :|...::....||         |...:.....:|..:....    ||.||:|.|::.::   
  Fly   198 IL-HIDVELLPRDICE---------KKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNE--- 249

  Fly   228 TLVGIVSHGFDGECKLK-LPDVSTRVSSYLKWI 259
            |:.|:||:...  |..| ||.:.|.|..::.||
  Fly   250 TVFGVVSYRVG--CGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 62/226 (27%)
Tryp_SPc 24..260 CDD:238113 64/228 (28%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 64/228 (28%)
Tryp_SPc 60..280 CDD:214473 62/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.