DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG7542

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:249 Identity:95/249 - (38%)
Similarity:130/249 - (52%) Gaps:28/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGK 88
            |.||..|:..|.|||.||...|   .:....||||::|:.||||||||:...:|    |.:::|.
  Fly    27 ITNGEPAEVGQFPYQAGLNVSF---GNWSTWCGGTLISHYWIITAAHCMDGAES----VTVYLGA 84

  Fly    89 VKSFDDKE-----IVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKK---- 144
            :...|:.|     |:|.:|..|||..:...||.|||:||:||..:.|...|:.|.||....    
  Fly    85 INIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFP 149

  Fly   145 TYTGRKAIISGWGLTT--KQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSK 207
            ||...:|..||||..:  ....|.||:|:..||:.:..|...|:   |..|:|:     ||:.:.
  Fly   150 TYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWS---GAVSEKM-----ICMSTT 206

  Fly   208 KG-LPCRGDSGGPMVLDDG-SRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259
            .| ..|.||||||:|...| |..|:|..|.|....|::..|.|.||:||||.||
  Fly   207 SGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 93/247 (38%)
Tryp_SPc 24..260 CDD:238113 95/249 (38%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 95/249 (38%)
Tryp_SPc 27..260 CDD:214473 93/247 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470947
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.