DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG18179

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:271 Identity:85/271 - (31%)
Similarity:121/271 - (44%) Gaps:44/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHC 71
            |:.|.::..|.|.   ||:||..|...:.||.||||...:|| :...:..|||:::.||:|||||
  Fly    26 LLPQVTISEGAEG---RIVNGYPAPEGKAPYIVGLLIRTDGS-NSAAVGAGTIIASDWILTAAHC 86

  Fly    72 LQDPKSNLWKVLIHVGKVKSFDDK-EIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQ 135
            |...     .|.||.|....::.. ...|.|...|.|..:..:. ..||.||:.| .:.|...|.
  Fly    87 LTTD-----YVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEG-GRDIGLIRTP-SVGFTDLIN 144

  Fly   136 PAKLPSAKK---TYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQW---------NKQ 188
            ...|||..:   .:.....:..|||.......:..||.:...||||.|||:.:         .::
  Fly   145 KVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRR 209

  Fly   189 LGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVS 253
            ..|||.                 |.||||||:|..|.:| |||:::.| ..:|. ..|...|||:
  Fly   210 TDGKSS-----------------CGGDSGGPLVTHDNAR-LVGVITFG-SVDCH-SGPSGYTRVT 254

  Fly   254 SYLKWIKYYSG 264
            .||.||:..:|
  Fly   255 DYLGWIRDNTG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 78/248 (31%)
Tryp_SPc 24..260 CDD:238113 78/248 (31%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 78/248 (31%)
Tryp_SPc 40..263 CDD:238113 79/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470979
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.