DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG8329

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:248 Identity:74/248 - (29%)
Similarity:114/248 - (45%) Gaps:34/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGK 88
            |:||..|...:.||.|||      ..:...:.||:::.|.|::||||||...     .|.||.|.
  Fly    35 IVNGYPAYEGKAPYAVGL------RMNNGAVGGGSVIGNNWVLTAAHCLTTD-----SVTIHYGS 88

  Fly    89 VKSFDDK-EIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRK-- 150
            .::::.: :..||::....|..:. .:..:||.||:.| .::|...|....||  |.:..|.:  
  Fly    89 NRAWNGQLQHTVNKNNFFRHPGYP-NSAGHDIGLIRTP-YVSFTNLINKVSLP--KFSQKGERFE 149

  Fly   151 ---AIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGLP- 211
               .:..|||.......:..||.:...:|||.||.|.:..         |.:..:|..:..|.. 
  Fly   150 NWWCVACGWGGMANGGLADWLQCMDVQVISNGECARSYGS---------VASTDMCTRATDGKSV 205

  Fly   212 CRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264
            |.|||||.:|..| :...||:::....| || ..|...||||.:|.||:..||
  Fly   206 CGGDSGGALVTHD-NPIQVGVITFASIG-CK-SGPSGYTRVSDHLDWIREKSG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/241 (29%)
Tryp_SPc 24..260 CDD:238113 71/242 (29%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 72/244 (30%)
Tryp_SPc 35..250 CDD:214473 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470971
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.