DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG3088

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:118/270 - (43%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILQLVLIVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNM-CGGTILSNRW 64
            :.|.|.|:...|.....|.....|.||:.|...|.||.||:      :..:.|: |.|||:.:.|
  Fly     6 VFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGM------AFGQSNIWCSGTIIGDTW 64

  Fly    65 IITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLT 129
            |:|:|.||.....    |.|:.|..:       :....:|:.....:..|....:||:::| ::.
  Fly    65 ILTSAQCLTGSSG----VTIYFGATR-------LSQAQFTVTVGTSEYVTGNQHLALVRVP-RVG 117

  Fly   130 FNKYIQPAKLPSAK---KTYTGRKAIISGWGLTT-KQLPSQVLQYIRAPIISNKECERQWNKQLG 190
            |:..:....|||.:   :.|....|.:.|||:|| ....:..||.:...|:||.||       :.
  Fly   118 FSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNEC-------IA 175

  Fly   191 GKSKKVVHNGFICIDSKKG-LPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSS 254
            ......|.:..:|..:..| ..|.||:|.|::....| |:|||.:......|.|.||....|::|
  Fly   176 FYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDS-TVVGISAFVASNGCTLGLPAGFARITS 239

  Fly   255 YLKWIKYYSG 264
            .|.||...:|
  Fly   240 ALDWIHQRTG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 66/241 (27%)
Tryp_SPc 24..260 CDD:238113 67/241 (28%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 68/242 (28%)
Tryp_SPc 29..244 CDD:214473 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470983
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.