DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:252 Identity:80/252 - (31%)
Similarity:112/252 - (44%) Gaps:41/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87
            ||.||..|:..:.||.|||  .|.|..    .|||:|:||.|::||.||:...     .|.::.|
  Fly    36 RITNGYPAEEGKAPYTVGL--GFSGGW----WCGGSIISNEWVLTAEHCIGGD-----AVTVYFG 89

  Fly    88 KVKSFDDKEIVVNRSYTIVHKKFDRKTVTN---DIALIKLPKKLTFNKYIQPAKLPSAKKTYTGR 149
            ....       .|..:|  |.......:|:   |||||::| .:.|...:...:|||....|...
  Fly    90 ATWR-------TNAQFT--HWVGSGNFITHGSADIALIRIP-HVDFWHMVNKVELPSYNDRYNDY 144

  Fly   150 K---AIISGWGLTTKQLP-SQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFIC---IDSK 207
            .   |:..|||.|....| ...||.:...||.|.||...:       ....|.:..||   :|.|
  Fly   145 NEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECASYY-------GTGTVGDNIICVRVVDGK 202

  Fly   208 KGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264
            .  .|.||||||:|..|||: |||:.:......|:...|....||:.:|.||:.::|
  Fly   203 G--TCGGDSGGPLVTHDGSK-LVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIRDHTG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 77/245 (31%)
Tryp_SPc 24..260 CDD:238113 77/245 (31%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 77/245 (31%)
Tryp_SPc 37..254 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471015
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.