DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and sphinx2

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:278 Identity:77/278 - (27%)
Similarity:133/278 - (47%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILQLVLIVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWI 65
            ::..|||.:.|| |..:...|.||..|..||...:.|.||:: |.:..........|||:||:||
  Fly     4 VVALLVLSLTFS-VCEKNKLSPRITGGYRAKPYTIIYLVGIV-YAKSPLSSLKFGAGTIISNQWI 66

  Fly    66 ITAAHCLQDPKSNLWKVL-IHVGKVKSFDDKEIV-VNRSYTIVHKKFDRKTVTNDIALIKLPKKL 128
            :|....|      ::|.: .|.|..::|...:|: :.|.....|  :|:   |..|||:|.|.: 
  Fly    67 LTVKEVL------IFKYIEAHFGSKRAFWGYDILRIYRENFYFH--YDK---TRIIALVKCPYQ- 119

  Fly   129 TFNKYIQPAKLPS--AK-KTYTGRKAIISGWGLTTK--QLPSQVLQYIRAPIISNKECER----- 183
            .|::.:...::|:  |: :.|.|...::.|||...:  :||:. ::.:...:::|.||.:     
  Fly   120 KFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDKRKVRLPTW-MRCVEVEVMNNTECAKYHTPL 183

  Fly   184 QWNKQLGGKSKKVVHNGFICIDSK--KGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLP 246
            :|.:              :|...:  ||: |.||.||.:|....:.|.:||: ......|.:..|
  Fly   184 KWYE--------------MCTSGEGFKGV-CEGDMGGAVVTMGPNPTFIGII-WLMPTNCSIGYP 232

  Fly   247 DVSTRVSSYLKWIKYYSG 264
            .|..|||.::||||:.||
  Fly   233 SVHIRVSDHIKWIKHVSG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 65/249 (26%)
Tryp_SPc 24..260 CDD:238113 65/249 (26%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 65/249 (26%)
Tryp_SPc 26..248 CDD:304450 67/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.