DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG10472

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:262 Identity:114/262 - (43%)
Similarity:144/262 - (54%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSN 78
            |.|:...|.||..|..|:..|.|||||||.|..|.   ...|||||:|:|||||||||.....:.
  Fly    37 VHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGG---AAWCGGTIISDRWIITAAHCTDSLTTG 98

  Fly    79 LWKVLIHVGKVKSFDDKE-----IVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAK 138
               |.:::|.....:.||     |.|.....|||:.:..:|:||||:|||||..:.|||||||||
  Fly    99 ---VDVYLGAHDRTNAKEEGQQIIFVETKNVIVHEDWIAETITNDISLIKLPVPIEFNKYIQPAK 160

  Fly   139 LP---SAKKTYTGRKAIISGWGLTTKQL--PSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVH 198
            ||   .:..||.|..||.||||..:...  .:.:|||...||::|..|. .|...|...|.    
  Fly   161 LPVKSDSYSTYGGENAIASGWGKISDSATGATDILQYATVPIMNNSGCS-PWYFGLVAASN---- 220

  Fly   199 NGFICIDSKKGL-PCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYY 262
               |||.:..|: .|.||||||:||||||.||:|..|.|....|::..|.|.||::.||.||:..
  Fly   221 ---ICIKTTGGISTCNGDSGGPLVLDDGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEK 282

  Fly   263 SG 264
            ||
  Fly   283 SG 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 107/246 (43%)
Tryp_SPc 24..260 CDD:238113 107/246 (43%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 107/246 (43%)
Tryp_SPc 47..282 CDD:238113 108/248 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470943
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.