DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG1299

DIOPT Version :10

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:253 Identity:72/253 - (28%)
Similarity:126/253 - (49%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCL-QDPKSNLWKVLIHV 86
            :|:.|..::....|: :.||.|.:.| ..|..||||:::.|.::|||||: ||.:      .:.:
  Fly   260 KIVGGEVSRKGAWPW-IALLGYDDPS-GSPFKCGGTLITARHVLTAAHCIRQDLQ------FVRL 316

  Fly    87 GKVKSFDDKE---IVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSA----KK 144
            |:.....|.|   :.:|.:..:.|..::|:...:|:|::.|.:.:.|...|.|..||..    :|
  Fly   317 GEHDLSTDTETGHVDINIARYVSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQK 381

  Fly   145 TYTGRKAIISGWGLTTKQLPS-QVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKK 208
            :|.|....::|||.|.:...| |||..::.||..||.|.:.:.|:....|........:|.....
  Fly   382 SYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLS 446

  Fly   209 G--LPCRGDSGGPMVLDDGSR-----TLVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259
            |  ..|:||||||::|.:..:     .|:|:||:|. |..:..:|.|.:....::.||
  Fly   447 GGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYGI-GCARPNVPGVYSSTQYFMDWI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/251 (28%)
CG1299NP_647862.1 CLIP 37..92 CDD:463440
CLIP 164..216 CDD:463440
Tryp_SPc 261..503 CDD:238113 70/250 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.