DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG12133

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:129/277 - (46%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLVFGQETGSLRIMNGTAAKAKQLPYQV--GLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQD 74
            |.|.||...|..|:.|..|::.|.|:.|  |...|....:..| ||.|:::::|:::||||||. 
  Fly    50 SRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSP-MCAGSLIASRYVLTAAHCLN- 112

  Fly    75 PKSNLWKVLIHVGKVKSFDDKE---------------IVVNRSYTIVHKKFDRKTVT--NDIALI 122
             .::.:...:.:|:..:.:|.:               :.::....:.|:::..:...  |||||:
  Fly   113 -VNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALL 176

  Fly   123 KLPKKLTFNKYIQPAKL-PSAKKTYTGRKAI---ISGWGLTTKQLPSQVLQYIRAPIISNKECER 183
            :|..::.:...|:|..: |..:.:.:..|..   |:|||.:..|..|.||:......:|..||..
  Fly   177 RLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLN 241

  Fly   184 QWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPMVLDDGSRT-----LVGIVSHGFDGECKL 243
            ::...|..|..::...|:...|:  ||   ||||.|::...|...     |.||.|:|.......
  Fly   242 RYPTLLVDKDIQICAMGWDGTDT--GL---GDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYG 301

  Fly   244 KLPDVSTRVSSYLKWIK 260
            ..|.|.|:.|||.:|||
  Fly   302 YGPAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 66/263 (25%)
Tryp_SPc 24..260 CDD:238113 67/263 (25%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 69/265 (26%)
Tryp_SPc 62..317 CDD:214473 66/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.