DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Jon44E

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:250 Identity:89/250 - (35%)
Similarity:124/250 - (49%) Gaps:29/250 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87
            ||.||..|...::||.|||     ...|....|||:|:.:.|::|||||.....    .|||:.|
  Fly    40 RITNGYPAYEGKIPYIVGL-----SFNDGGYWCGGSIIDHTWVLTAAHCTNSAN----HVLIYFG 95

  Fly    88 KVKSFDDKEIV---VNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAK---KTY 146
              .||..:...   |:||..|.|..:: ..:.||||||::| .:.|...:...:|||..   .:|
  Fly    96 --ASFRHEAQYTHWVSRSDMIQHPDWN-DFLNNDIALIRIP-HVDFWSLVNKVELPSYNDRYNSY 156

  Fly   147 TGRKAIISGWGLTTKQL-PSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKG- 209
            :|..|:.||||||.... .|..|..:...||.|.:|...:       ....:.:..|||::..| 
  Fly   157 SGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYY-------GSNYITDNTICINTDGGK 214

  Fly   210 LPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264
            ..|.||||||:||.|.:| :|||||.|....|....|...|||:.||.||:.::|
  Fly   215 SSCSGDSGGPLVLHDNNR-IVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIRDHTG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 86/243 (35%)
Tryp_SPc 24..260 CDD:238113 86/243 (35%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 86/243 (35%)
Tryp_SPc 41..266 CDD:238113 87/245 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471023
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.