DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and try-9

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:224 Identity:60/224 - (26%)
Similarity:92/224 - (41%) Gaps:63/224 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GTILSNRWIITAAHCL---QDP-----KSNLWKVLIHVGKVKSFDDKEIVVNRSYTI------VH 107
            ||::|...|:||||.:   :||     ..||.:...    |:.:.:....||.:..:      :|
 Worm    30 GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYF----VRDYKNFVAFVNVTCAVPEMCKGLH 90

  Fly   108 KK----------------------FDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKK----TY 146
            :|                      .||::. ||||:.:|.:.:.|:|.|.||.||||.|    ..
 Worm    91 RKDMFKPLAIKSLYIRKGYVGDGCIDRESF-NDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRE 154

  Fly   147 TGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDS-KKGL 210
            ||.|....|...:...|.|..|:.:.:.:   .||           |....:.|..|..: .:||
 Worm   155 TGYKLFGYGRDPSDSVLESGKLKSLYSFV---AEC-----------SDDFPYGGVYCTSAVNRGL 205

  Fly   211 PCRGDSGGPMVLDDGSR---TLVGIVSHG 236
            .|.||||..:|....:|   .|||::|.|
 Worm   206 SCDGDSGSGVVRTSDTRNVQVLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 60/224 (27%)
Tryp_SPc 24..260 CDD:238113 60/224 (27%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 60/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.