DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG17572

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:219 Identity:57/219 - (26%)
Similarity:102/219 - (46%) Gaps:14/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIV---------VNR--SYTIVHK 108
            |.|.:::.|.|:|||||............:.||:..:..|.:..         ||.  |:.|||.
  Fly   160 CAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHP 224

  Fly   109 KFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAK-KTYTGRKAIISGWG-LTTKQLPSQVLQYI 171
            .:.:....:||||:.|...|.::...||..|...: ....|::|.|:||| ::|..:....:.::
  Fly   225 DYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHL 289

  Fly   172 RAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGLPCRGDSGGPM-VLDDGSRTLVGIVSH 235
            ..|:.|...|.|.:......:|...:...::|...:....|:|..|.|: :.::|..:.:||:|.
  Fly   290 DVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPLFIQENGIFSQIGIMSF 354

  Fly   236 GFDGECKLKLPDVSTRVSSYLKWI 259
            |.|....|::|.|.|.|:.:.:||
  Fly   355 GSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 55/217 (25%)
Tryp_SPc 24..260 CDD:238113 57/219 (26%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 57/219 (26%)
Tryp_SPc 138..378 CDD:214473 55/217 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.