DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Jon25Bii

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001285608.1 Gene:Jon25Bii / 33707 FlyBaseID:FBgn0031654 Length:276 Species:Drosophila melanogaster


Alignment Length:261 Identity:86/261 - (32%)
Similarity:123/261 - (47%) Gaps:28/261 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFGQETGSL--RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPN--MCGGTILSNRWIITAAHCLQD 74
            |.|..:||:  ||.||..|...::||.|||     |...:..  .|||:|:.:.|:||||||...
  Fly    31 VLGSGSGSIEGRITNGYPAYEGKVPYIVGL-----GFSSDSGGWWCGGSIIGHTWVITAAHCTHG 90

  Fly    75 PKSNLWKVLIHVGKVKSFDDKEI-VVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAK 138
            ..|    |.|:.|.:.....:.. .|...:...|..::...:.|||:||..| .:.|...|...:
  Fly    91 AHS----VTIYYGALWRLQAQYTHTVGSGHFRQHSDYNTNNLNNDISLINTP-HVDFWHLINKVE 150

  Fly   139 LPSAKK---TYTGRKAIISGWGLTTKQL-PSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHN 199
            ||...:   ::.|..|:.||||...... .|..|..:.:.||:..||...:...       |:.:
  Fly   151 LPDGNERHDSFAGWWALASGWGRPCDSCGVSDYLNCVDSQIITRDECSSVYGTD-------VITD 208

  Fly   200 GFICIDSKKG-LPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYS 263
            ..||..:..| ..|.||||||:||.|.|: |||:.|......|...|||..|||:|||.||:.::
  Fly   209 NVICTSTPGGKSTCAGDSGGPLVLHDRSK-LVGVTSFVAASGCTSGLPDGFTRVTSYLDWIRDHT 272

  Fly   264 G 264
            |
  Fly   273 G 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 79/243 (33%)
Tryp_SPc 24..260 CDD:238113 79/243 (33%)
Jon25BiiNP_001285608.1 Tryp_SPc 42..268 CDD:214473 79/243 (33%)
Tryp_SPc 43..271 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471027
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.