DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and psh

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:227 Identity:67/227 - (29%)
Similarity:117/227 - (51%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVK------SFDDKEIVVNRSYTI----VHKK 109
            |||:::::|:::|||||:....:.  ...:.:|.|.      |:.|   :|.||..|    |..|
  Fly   172 CGGSLIASRFVLTAAHCVNTDANT--PAFVRLGAVNIENPDHSYQD---IVIRSVKIHPQYVGNK 231

  Fly   110 FDRKTVTNDIALIKLPKKLTFNKYIQPAKL-PSAKKTYTGRKAIISGWGL--TTKQLPSQVLQYI 171
            :      ||||:::|.:.:.....|:||.| ..|....:..|..::|||:  .|.:..|::|...
  Fly   232 Y------NDIAILELERDVVETDNIRPACLHTDATDPPSNSKFFVAGWGVLNVTTRARSKILLRA 290

  Fly   172 RAPIISNKECERQWNKQLGG--KSKKVVHNGFICIDSKKGL--PCRGDSGGPMV----LDDGSRT 228
            ...::...:|...:.:|.|.  ..|:.|.:..:|...:|.:  .|:||||||::    ::||..|
  Fly   291 GLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCAIDQKLIADACKGDSGGPLIHELNVEDGMYT 355

  Fly   229 LVGIVSHGFDGECKLKLPDVSTRVSSYLKWIK 260
            ::|::|.||.  |....|.:.|||||||.:|:
  Fly   356 IMGVISSGFG--CATVTPGLYTRVSSYLDFIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 66/224 (29%)
Tryp_SPc 24..260 CDD:238113 66/225 (29%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 66/224 (29%)
Tryp_SPc 144..387 CDD:238113 67/227 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437061
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.