DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Hayan

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:265 Identity:69/265 - (26%)
Similarity:125/265 - (47%) Gaps:43/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIH 85
            ::.|::|........|:...:.....||  ....|||:::::|:::|||||:....|.  ...:.
  Fly   382 TVHILDGERVDRGVYPHMAAIAYNSFGS--AAFRCGGSLIASRFVLTAAHCVNSDDST--PSFVR 442

  Fly    86 VGKVK------SFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKK 144
            :|.:.      .:.|    :|.....:|..:...:...|||:::|.:....:..|:||.|     
  Fly   443 LGALNIENPEPGYQD----INVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACL----- 498

  Fly   145 TYTGR-------KAIISGWGL--TTKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNG 200
             ||.|       |..::|||:  .|.:..|::|......::...||...:.:|  ..:.:.:..|
  Fly   499 -YTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQ--PSANRTLRRG 560

  Fly   201 FI----CIDSK--KGLPCRGDSGGPMVLD----DGSRTLVGIVSHGFDGECKLKLPDVSTRVSSY 255
            .|    |...|  :...|:||||||::|:    ||:.::||::|.||.  |..|.|.:.|||||:
  Fly   561 VIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFG--CATKTPGLYTRVSSF 623

  Fly   256 LKWIK 260
            |.:|:
  Fly   624 LDYIE 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 68/260 (26%)
Tryp_SPc 24..260 CDD:238113 68/260 (26%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 68/260 (26%)
Tryp_SPc 385..630 CDD:238113 69/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437062
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.