DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and CG8952

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:285 Identity:90/285 - (31%)
Similarity:142/285 - (49%) Gaps:43/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQLVLIVQFSLV---FGQETGS-----LRIMNGTAAKAKQLPYQVGLLCYFEGSKD--EPNMCGG 57
            |.|||:...|:|   |.....|     .||::|:.||..|.|:||.|      .:|  :..:|||
  Fly     9 LMLVLLAAISVVGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVIL------KRDAWDDLLCGG 67

  Fly    58 TILSNRWIITAAHCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALI 122
            :|:|:.|::|||||    .:.|..:.:..|.|..|:...:.:..:..|:|..::.| :.||::||
  Fly    68 SIISDTWVLTAAHC----TNGLSSIFLMFGTVDLFNANALNMTSNNIIIHPDYNDK-LNNDVSLI 127

  Fly   123 KLPKKLTFNKYIQPAKLPSA---KKTYTGRKAIISGWGLTTKQL--PSQVLQYIRAPIISNKECE 182
            :||:.|||:..||..:|...   ...|.|..|.|:|:|.|..:.  .|:.|.|.:..||.|.:|.
  Fly   128 QLPEPLTFSANIQAIQLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCV 192

  Fly   183 RQWNKQLGGKSKKVVHNGFIC---IDSKKGLPCRGDSGGPMVLDDGSRTL-----VGIVSHGFDG 239
            ..:.|.       ||.:..:|   .|......|.||||||::|  .::|:     :||.|...:.
  Fly   193 AIYGKY-------VVVDSTMCAKGFDGSDMSTCTGDSGGPLIL--YNKTIQQWQQIGINSFVAED 248

  Fly   240 ECKLKLPDVSTRVSSYLKWIKYYSG 264
            :|..:||....||||:|.:|...:|
  Fly   249 QCTYRLPSGYARVSSFLGFIADKTG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 80/250 (32%)
Tryp_SPc 24..260 CDD:238113 79/250 (32%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 80/250 (32%)
Tryp_SPc 38..271 CDD:238113 80/252 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471044
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.