DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and ctrb.1

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:259 Identity:81/259 - (31%)
Similarity:115/259 - (44%) Gaps:49/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEP--NMCGGTILSNRWIITAAHC---------- 71
            ||..||:||..|:....|:||.|       :|..  :.|||::::..|::|||||          
Zfish    29 TGYARIVNGEEARPHSWPWQVSL-------QDSTGFHFCGGSLINENWVVTAAHCNVRTSHRVIL 86

  Fly    72 -LQDPKSNLWKV-LIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYI 134
             ..|..||...: .|.|||               :|.|..::..|:.|||.||||......|.::
Zfish    87 GEHDRSSNAEAIQTIAVGK---------------SIKHPNYNSFTINNDILLIKLATPAKINTHV 136

  Fly   135 QPAKLPSAKKTYT-GRKAIISGWGLTTKQLPS--QVLQYIRAPIISNKECERQWNKQLGGKSKKV 196
            .|..|......:. |.|.:.||||||....|.  .:||....|:::|.:|:|.|...        
Zfish   137 SPVCLAETNDNFPGGMKCVTSGWGLTRYNAPDTPALLQQAALPLLTNDDCKRYWGTN-------- 193

  Fly   197 VHNGFICIDSKKGLPCRGDSGGPMVLDDGS-RTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259
            :.:..||..:.....|.||||||:|.::.. .|||||||.| ...|....|.|..||:....|:
Zfish   194 ITDLMICAGASGVSSCMGDSGGPLVCENNRVWTLVGIVSWG-SSTCSTSTPAVYARVTKLRAWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 78/253 (31%)
Tryp_SPc 24..260 CDD:238113 78/254 (31%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 78/253 (31%)
Tryp_SPc 34..259 CDD:238113 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.