DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Prss30

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:275 Identity:79/275 - (28%)
Similarity:133/275 - (48%) Gaps:56/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHC------- 71
            |.|....:.:|:.|..|...|.|:||.|....:|     ::|||:::...|::|||||       
Mouse    64 VCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDG-----HICGGSLIHEVWVLTAAHCFRRSLNP 123

  Fly    72 -------------LQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIK 123
                         |.:|.|.|..|            :.|.|:.:|......      :.||||::
Mouse   124 SFYHVKVGGLTLSLLEPHSTLVAV------------RNIFVHPTYLWADAS------SGDIALVQ 170

  Fly   124 LPKKLTFNKYIQPAKLPSAKKTYT-GRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNK 187
            |...|..::: .|..||:|:...| |....::|||.|.::..:.|||.:..|::.:::||:.::.
Mouse   171 LDTPLRPSQF-TPVCLPAAQTPLTPGTVCWVTGWGATQERDMASVLQELAVPLLDSEDCEKMYHT 234

  Fly   188 Q---LGGKSKKVVHNGFIC---IDSKKGLPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKL 245
            |   |.|  ::::.:..:|   ::.:|. .|:||||||:|.. :.|.|.|||.|.|. |..:...
Mouse   235 QGSSLSG--ERIIQSDMLCAGYVEGQKD-SCQGDSGGPLVCSINSSWTQVGITSWGI-GCARPYR 295

  Fly   246 PDVSTRVSSYLKWIK 260
            |.|.|||.:|:.||:
Mouse   296 PGVYTRVPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 75/263 (29%)
Tryp_SPc 24..260 CDD:238113 76/263 (29%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.