DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Mcpt2

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:259 Identity:69/259 - (26%)
Similarity:113/259 - (43%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHC 71
            |:...:|:.....|:..|:.|..:.....||...|....|  |....:|||.::|.::::|||||
  Rat     4 LLFLMALLLPSGAGAEEIIGGVESIPHSRPYMAHLDIVTE--KGLRVICGGFLISRQFVLTAAHC 66

  Fly    72 LQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQP 136
                |.....|::....|:..:..:..:.....|:|:.::.....:||.|:||.||:.....:..
  Rat    67 ----KGREITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLKLEKKVELTPAVNV 127

  Fly   137 AKLPSAKK-TYTGRKAIISGWGLTTKQLP-SQVLQYIRAPIISNKEC--ERQWNKQLGGKSKKVV 197
            ..|||... .:.|.....:|||.|..:.| |..|:.:...|:..|.|  .|.:..:..       
  Rat   128 VPLPSPSDFIHPGAMCWAAGWGKTGVRDPTSYTLREVELRIMDEKACVDYRYYEYKFQ------- 185

  Fly   198 HNGFICIDSKKGLPC--RGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWI 259
                :|:.|...|..  .||||||::.   :....||||:|..   ..|.|.:.||||:|:.||
  Rat   186 ----VCVGSPTTLRAAFMGDSGGPLLC---AGVAHGIVSYGHP---DAKPPAIFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 64/241 (27%)
Tryp_SPc 24..260 CDD:238113 66/242 (27%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 64/241 (27%)
Tryp_SPc 21..242 CDD:238113 66/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.