DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Sp212

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:122/267 - (45%) Gaps:38/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLVFGQETGSLR--IMNGTAAKAKQLPY-------QVGLLCYFEGSKDEPNMCGGTILSNRWIIT 67
            |:|.|:| ||..  |:.|......|.|:       :|..|.:         .|.|:::|:..:|:
  Fly   264 SVVCGRE-GSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAF---------KCRGSLISSSIVIS 318

  Fly    68 AAHCLQDPKSNLWKVLIHVGKVKSFD---DKEIVVNRSYTIVHKKFDRKTVTN-DIALIKLPKKL 128
            ||||:.....:  :|::.:|:....|   |...:.|....:.|..::.::.:: |||||.:.:.:
  Fly   319 AAHCVHRMTED--RVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDADIALITIERPV 381

  Fly   129 TFNKYIQPAKLPSAKKTYT-GRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGGK 192
            |||..|.|..:.:.:.:.| .....|:|||.......:|..:.:.|.|.|...|...|...:   
  Fly   382 TFNDIIAPICMWTVEASRTVSTTGFIAGWGRDEDSSRTQYPRVVEAEIASPTVCASTWRGTM--- 443

  Fly   193 SKKVVHNGFICIDSKKGL-PCRGDSGGPMVLDDGSRTLV-GIVS---HGFDGECKLKLPDVSTRV 252
                |....:|..::.|. ||.|||||.:::..|.|.|: ||||   .|..|.|:|....:...:
  Fly   444 ----VTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDL 504

  Fly   253 SSYLKWI 259
            |.::.||
  Fly   505 SKHINWI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 63/254 (25%)
Tryp_SPc 24..260 CDD:238113 65/253 (26%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 65/253 (26%)
Tryp_SPc 277..511 CDD:214473 63/251 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.