DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and Tpsg1

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:262 Identity:75/262 - (28%)
Similarity:127/262 - (48%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVL 83
            :|| ||:.|.||.|...|:|..|..:      :.::|||::||..|::|||||... ..|.....
Mouse    83 SGS-RIVGGHAAPAGTWPWQASLRLH------KVHVCGGSLLSPEWVLTAAHCFSG-SVNSSDYQ 139

  Fly    84 IHVGKVKSFDDKEIVVNRSYTIVHKKFDRKT-------VTNDIALIKLPKKLTFNKYIQPAKLPS 141
            :|:|::      .:.::..::.| |:....|       .:.||||::|...:..:..:||..||.
Mouse   140 VHLGEL------TVTLSPHFSTV-KRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPE 197

  Fly   142 AKKT-YTGRKAIISGWGLTTKQLPSQV---LQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFI 202
            |... |.|.:..::|||.|.:..|.:.   ||..:..::..|.|.:.:|...|    .::....:
Mouse   198 ASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNG----SLIQPDML 258

  Fly   203 CIDSKKGLPCRGDSGGPMVLD-DGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYY---S 263
            |... .|..|:.|||||:|.. .|:....|:||.| :|..:...|.|..||::|:.||.::   :
Mouse   259 CARG-PGDACQDDSGGPLVCQVAGTWQQAGVVSWG-EGCGRPDRPGVYARVTAYVNWIHHHIPEA 321

  Fly   264 GG 265
            ||
Mouse   322 GG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 69/247 (28%)
Tryp_SPc 24..260 CDD:238113 69/247 (28%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.