DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10469 and PRSS33

DIOPT Version :9

Sequence 1:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:281 Identity:75/281 - (26%)
Similarity:140/281 - (49%) Gaps:35/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQLVLIV---------QFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGT 58
            ||::|::         :.|...||...|.||:.|...:..:.|:|..:  ...|:    ::|||:
Human     7 LQVLLLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASI--QHRGA----HVCGGS 65

  Fly    59 ILSNRWIITAAHCLQDPKSNL---WKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIA 120
            :::.:|::|||||.  |:..|   ::|.:...::.|...:.:.|.....::...:.......|:|
Human    66 LIAPQWVLTAAHCF--PRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLA 128

  Fly   121 LIKLPKKLTFNKYIQPAKLP-SAKKTYTGRKAIISGWGLTTKQLPS---QVLQYIRAPIISNKEC 181
            |::|.:.:..:..:||..|| ...:...|....::|||.....:|.   :.||.:|.|::.::.|
Human   129 LLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTC 193

  Fly   182 ERQWNKQLGG---KSKKVVHNGFICIDSKKGL--PCRGDSGGPMV-LDDGSRTLVGIVSHGFDGE 240
            :..::  :|.   :::::|..|.:|....:|.  .|:||||||:. |..||..|||:||.|  ..
Human   194 DGLYH--VGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWG--KG 254

  Fly   241 CKL-KLPDVSTRVSSYLKWIK 260
            |.| ..|.|.|.|::|..||:
Human   255 CALPNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 66/249 (27%)
Tryp_SPc 24..260 CDD:238113 66/249 (27%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 66/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.